Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 482611..482833 | Replicon | chromosome |
| Accession | NZ_LR778153 | ||
| Organism | Escherichia coli isolate SC480 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | H1C95_RS02250 | Protein ID | WP_001295224.1 |
| Coordinates | 482726..482833 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 482611..482669 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C95_RS02225 | 477999..478982 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| H1C95_RS02230 | 478979..479983 | + | 1005 | WP_000107031.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| H1C95_RS02235 | 480013..481284 | - | 1272 | WP_033560857.1 | amino acid permease | - |
| H1C95_RS02240 | 481760..481867 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| H1C95_RS02245 | 482243..482350 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 482611..482669 | - | 59 | - | - | Antitoxin |
| H1C95_RS02250 | 482726..482833 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| H1C95_RS02255 | 482920..484599 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| H1C95_RS02260 | 484596..484787 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| H1C95_RS02265 | 484784..486355 | - | 1572 | WP_180343985.1 | cellulose biosynthesis protein BcsE | - |
| H1C95_RS02270 | 486628..486816 | + | 189 | WP_001063318.1 | YhjR family protein | - |
| H1C95_RS02275 | 486828..487580 | + | 753 | WP_000279528.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T289304 WP_001295224.1 NZ_LR778153:482726-482833 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT289304 NZ_LR778153:c482669-482611 [Escherichia coli]
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|