Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 481645..481867 Replicon chromosome
Accession NZ_LR778153
Organism Escherichia coli isolate SC480

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag H1C95_RS02240 Protein ID WP_001295224.1
Coordinates 481760..481867 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 481645..481711 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1C95_RS02220 477086..477988 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
H1C95_RS02225 477999..478982 + 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
H1C95_RS02230 478979..479983 + 1005 WP_000107031.1 dipeptide ABC transporter ATP-binding subunit DppF -
H1C95_RS02235 480013..481284 - 1272 WP_033560857.1 amino acid permease -
- 481645..481711 - 67 - - Antitoxin
H1C95_RS02240 481760..481867 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
H1C95_RS02245 482243..482350 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
H1C95_RS02250 482726..482833 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
H1C95_RS02255 482920..484599 - 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
H1C95_RS02260 484596..484787 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
H1C95_RS02265 484784..486355 - 1572 WP_180343985.1 cellulose biosynthesis protein BcsE -
H1C95_RS02270 486628..486816 + 189 WP_001063318.1 YhjR family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T289302 WP_001295224.1 NZ_LR778153:481760-481867 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT289302 NZ_LR778153:c481711-481645 [Escherichia coli]
GTCTAGATGCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References