Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 95256..95858 | Replicon | chromosome |
Accession | NZ_LR778153 | ||
Organism | Escherichia coli isolate SC480 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | H1C95_RS00425 | Protein ID | WP_000897305.1 |
Coordinates | 95547..95858 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | H1C95_RS00420 | Protein ID | WP_000356397.1 |
Coordinates | 95256..95546 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C95_RS00395 | 91182..92084 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
H1C95_RS00400 | 92081..92716 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
H1C95_RS00405 | 92713..93642 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
H1C95_RS00410 | 93972..94214 | - | 243 | WP_001087409.1 | hypothetical protein | - |
H1C95_RS00415 | 94433..94651 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
H1C95_RS00420 | 95256..95546 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
H1C95_RS00425 | 95547..95858 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
H1C95_RS00430 | 96087..96995 | + | 909 | WP_001299484.1 | alpha/beta hydrolase | - |
H1C95_RS00435 | 97059..98000 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
H1C95_RS00440 | 98045..98482 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
H1C95_RS00445 | 98479..99351 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
H1C95_RS00450 | 99345..99944 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T289301 WP_000897305.1 NZ_LR778153:c95858-95547 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|