Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4104650..4105449 | Replicon | chromosome |
Accession | NZ_LR778152 | ||
Organism | Escherichia coli isolate SC477 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | H1D09_RS19915 | Protein ID | WP_087598199.1 |
Coordinates | 4104650..4105114 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | H1D09_RS19920 | Protein ID | WP_087598198.1 |
Coordinates | 4105114..4105449 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D09_RS19885 | 4099651..4100085 | - | 435 | WP_137527029.1 | PTS sugar transporter subunit IIA | - |
H1D09_RS19890 | 4100103..4100981 | - | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
H1D09_RS19895 | 4100971..4101750 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
H1D09_RS19900 | 4101761..4102234 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
H1D09_RS19905 | 4102257..4103537 | - | 1281 | WP_137527028.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
H1D09_RS19910 | 4103786..4104595 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
H1D09_RS19915 | 4104650..4105114 | - | 465 | WP_087598199.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
H1D09_RS19920 | 4105114..4105449 | - | 336 | WP_087598198.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
H1D09_RS19925 | 4105598..4107169 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
H1D09_RS19930 | 4107544..4108878 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
H1D09_RS19935 | 4108894..4109664 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17811.16 Da Isoelectric Point: 9.4947
>T289297 WP_087598199.1 NZ_LR778152:c4105114-4104650 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|