Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 3677016..3678334 | Replicon | chromosome |
Accession | NZ_LR778152 | ||
Organism | Escherichia coli isolate SC477 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | - |
Locus tag | H1D09_RS17790 | Protein ID | WP_024225716.1 |
Coordinates | 3677327..3678334 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A2A7M399 |
Locus tag | H1D09_RS17785 | Protein ID | WP_001490601.1 |
Coordinates | 3677016..3677327 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D09_RS17760 | 3672548..3673567 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
H1D09_RS17765 | 3673577..3674479 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
H1D09_RS17770 | 3674490..3675473 | + | 984 | WP_112886706.1 | dipeptide ABC transporter ATP-binding protein | - |
H1D09_RS17775 | 3675470..3676483 | + | 1014 | WP_053898372.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
H1D09_RS17780 | 3676708..3677031 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
H1D09_RS17785 | 3677016..3677327 | + | 312 | WP_001490601.1 | HipA N-terminal domain-containing protein | Antitoxin |
H1D09_RS17790 | 3677327..3678334 | + | 1008 | WP_024225716.1 | HipA domain-containing protein | Toxin |
H1D09_RS17795 | 3678351..3679622 | - | 1272 | WP_001312176.1 | amino acid permease | - |
H1D09_RS17800 | 3680098..3680205 | + | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
H1D09_RS17805 | 3680581..3680688 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
H1D09_RS17810 | 3680774..3682453 | - | 1680 | WP_000191568.1 | cellulose biosynthesis protein BcsG | - |
H1D09_RS17815 | 3682450..3682641 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38384.63 Da Isoelectric Point: 5.6166
>T289293 WP_024225716.1 NZ_LR778152:3677327-3678334 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLNEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVSVHGLLSFAPQSEEELEYAFVIRRYDRDYKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPTLAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLNEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVSVHGLLSFAPQSEEELEYAFVIRRYDRDYKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPTLAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|