Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3235587..3236350 | Replicon | chromosome |
| Accession | NZ_LR778152 | ||
| Organism | Escherichia coli isolate SC477 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | H1D09_RS15660 | Protein ID | WP_175058636.1 |
| Coordinates | 3235587..3235949 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | H1D09_RS15665 | Protein ID | WP_180344732.1 |
| Coordinates | 3235931..3236350 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D09_RS15630 | 3231637..3232539 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| H1D09_RS15635 | 3232536..3233171 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| H1D09_RS15640 | 3233168..3234097 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| H1D09_RS15645 | 3234134..3234508 | - | 375 | WP_001129490.1 | type II toxin-antitoxin system VapC family toxin | - |
| H1D09_RS15650 | 3234508..3234750 | - | 243 | WP_001591266.1 | ribbon-helix-helix domain-containing protein | - |
| H1D09_RS15655 | 3234970..3235188 | - | 219 | WP_001468130.1 | ribbon-helix-helix domain-containing protein | - |
| H1D09_RS15660 | 3235587..3235949 | + | 363 | WP_175058636.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| H1D09_RS15665 | 3235931..3236350 | + | 420 | WP_180344732.1 | helix-turn-helix domain-containing protein | Antitoxin |
| H1D09_RS15670 | 3236361..3237302 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| H1D09_RS15675 | 3237347..3237784 | - | 438 | WP_000560990.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| H1D09_RS15680 | 3237781..3238653 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| H1D09_RS15685 | 3238647..3239246 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
| H1D09_RS15690 | 3239345..3240130 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| H1D09_RS15695 | 3240164..3241060 | - | 897 | WP_000621626.1 | sulfofructose kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14363.48 Da Isoelectric Point: 9.3668
>T289292 WP_175058636.1 NZ_LR778152:3235587-3235949 [Escherichia coli]
MHVISHKPFNEAIKCFPPYEGALIDLLNLLEKTEFSDPGEMKRYIPSLDNFKYRDKLWVINIAGNHLRLIAYIDFRLQKC
FIKHTVIYNEYDRFTTWHRSHKNENPSHPSRRLGQFWNAG
MHVISHKPFNEAIKCFPPYEGALIDLLNLLEKTEFSDPGEMKRYIPSLDNFKYRDKLWVINIAGNHLRLIAYIDFRLQKC
FIKHTVIYNEYDRFTTWHRSHKNENPSHPSRRLGQFWNAG
Download Length: 363 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15843.18 Da Isoelectric Point: 6.3281
>AT289292 WP_180344732.1 NZ_LR778152:3235931-3236350 [Escherichia coli]
ILECWLRPSPHAVKDIPLCGPKADQEEYHNALKLIEFLVDRDDLENPLFELLCVRIREYENNAPEFQHFNQRLASTPCGV
SLLRILMDQHGLKAADLAQELGSKSNVSNILNGRRALTVRHIKALSERFNLPAEAFIDK
ILECWLRPSPHAVKDIPLCGPKADQEEYHNALKLIEFLVDRDDLENPLFELLCVRIREYENNAPEFQHFNQRLASTPCGV
SLLRILMDQHGLKAADLAQELGSKSNVSNILNGRRALTVRHIKALSERFNLPAEAFIDK
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|