Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2369538..2370232 | Replicon | chromosome |
Accession | NZ_LR778152 | ||
Organism | Escherichia coli isolate SC477 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | H1D09_RS11640 | Protein ID | WP_001263500.1 |
Coordinates | 2369538..2369936 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | H1D09_RS11645 | Protein ID | WP_000554758.1 |
Coordinates | 2369939..2370232 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D09_RS11615 | 2364847..2365305 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
H1D09_RS11620 | 2365566..2367023 | + | 1458 | WP_175058567.1 | cytosol nonspecific dipeptidase | - |
H1D09_RS11625 | 2367080..2367694 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
H1D09_RS11630 | 2367691..2368830 | - | 1140 | WP_180344730.1 | RNA ligase RtcB family protein | - |
H1D09_RS11635 | 2369076..2369528 | - | 453 | WP_089573738.1 | GNAT family N-acetyltransferase | - |
H1D09_RS11640 | 2369538..2369936 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
H1D09_RS11645 | 2369939..2370232 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
H1D09_RS11650 | 2370284..2371339 | - | 1056 | WP_001226166.1 | DNA polymerase IV | - |
H1D09_RS11655 | 2371410..2372333 | - | 924 | WP_060578024.1 | putative lateral flagellar export/assembly protein LafU | - |
H1D09_RS11660 | 2372336..2373199 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
H1D09_RS11665 | 2373212..2373928 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
H1D09_RS11670 | 2373948..2374415 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T289288 WP_001263500.1 NZ_LR778152:c2369936-2369538 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|