Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3919775..3920377 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | H1C97_RS18900 | Protein ID | WP_000897305.1 |
Coordinates | 3919775..3920086 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | H1C97_RS18905 | Protein ID | WP_000356397.1 |
Coordinates | 3920087..3920377 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS18870 | 3914805..3915590 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
H1C97_RS18875 | 3915689..3916288 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
H1C97_RS18880 | 3916282..3917154 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
H1C97_RS18885 | 3917151..3917588 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
H1C97_RS18890 | 3917633..3918574 | + | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
H1C97_RS18895 | 3918638..3919546 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
H1C97_RS18900 | 3919775..3920086 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
H1C97_RS18905 | 3920087..3920377 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
H1C97_RS18910 | 3920982..3921200 | + | 219 | WP_001297075.1 | ribbon-helix-helix domain-containing protein | - |
H1C97_RS18915 | 3921419..3921661 | + | 243 | WP_001086388.1 | hypothetical protein | - |
H1C97_RS18920 | 3921991..3922920 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
H1C97_RS18925 | 3922917..3923552 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
H1C97_RS18930 | 3923549..3924451 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T289276 WP_000897305.1 NZ_LR778151:3919775-3920086 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|