Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3110473..3111272 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | H1C97_RS14995 | Protein ID | WP_000347266.1 |
Coordinates | 3110808..3111272 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | H1C97_RS14990 | Protein ID | WP_001307405.1 |
Coordinates | 3110473..3110808 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS14975 | 3106258..3107028 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
H1C97_RS14980 | 3107044..3108378 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
H1C97_RS14985 | 3108753..3110324 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
H1C97_RS14990 | 3110473..3110808 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
H1C97_RS14995 | 3110808..3111272 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
H1C97_RS15000 | 3111327..3112136 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
H1C97_RS15005 | 3112385..3113665 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
H1C97_RS15010 | 3113688..3114161 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
H1C97_RS15015 | 3114172..3114951 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
H1C97_RS15020 | 3114941..3115819 | + | 879 | WP_001298758.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
H1C97_RS15025 | 3115837..3116271 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3099817..3111272 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T289274 WP_000347266.1 NZ_LR778151:3110808-3111272 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |