Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1363893..1364495 | Replicon | chromosome |
| Accession | NZ_LR778148 | ||
| Organism | Escherichia coli isolate SC475 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | H1C74_RS06605 | Protein ID | WP_000897305.1 |
| Coordinates | 1363893..1364204 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | H1C74_RS06610 | Protein ID | WP_000356397.1 |
| Coordinates | 1364205..1364495 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C74_RS06580 | 1359807..1360406 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| H1C74_RS06585 | 1360400..1361272 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| H1C74_RS06590 | 1361269..1361706 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| H1C74_RS06595 | 1361751..1362692 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| H1C74_RS06600 | 1362756..1363664 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| H1C74_RS06605 | 1363893..1364204 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| H1C74_RS06610 | 1364205..1364495 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| H1C74_RS06615 | 1365100..1365318 | + | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
| H1C74_RS06620 | 1365537..1365779 | + | 243 | WP_001087409.1 | hypothetical protein | - |
| H1C74_RS06625 | 1366109..1367038 | - | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
| H1C74_RS06630 | 1367035..1367670 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| H1C74_RS06635 | 1367667..1368569 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T289214 WP_000897305.1 NZ_LR778148:1363893-1364204 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|