Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4579310..4580004 Replicon chromosome
Accession NZ_LR778147
Organism Escherichia coli isolate SC418

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag H1D11_RS21775 Protein ID WP_001521903.1
Coordinates 4579310..4579708 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag H1D11_RS21780 Protein ID WP_000554758.1
Coordinates 4579711..4580004 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D11_RS21745 4574480..4575724 - 1245 WP_000189541.1 esterase FrsA -
- 4575140..4575220 - 81 NuclAT_11 - -
- 4575140..4575220 - 81 NuclAT_11 - -
- 4575140..4575220 - 81 NuclAT_11 - -
- 4575140..4575220 - 81 NuclAT_11 - -
H1D11_RS21750 4575816..4576274 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
H1D11_RS21755 4576535..4577992 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
H1D11_RS24750 4578049..4578401 - 353 Protein_4244 peptide chain release factor H -
H1D11_RS21765 4578397..4578603 - 207 Protein_4245 RtcB family protein -
H1D11_RS21770 4578848..4579300 - 453 WP_001059899.1 GNAT family N-acetyltransferase -
H1D11_RS21775 4579310..4579708 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
H1D11_RS21780 4579711..4580004 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
H1D11_RS21785 4580056..4581111 - 1056 WP_001226164.1 DNA polymerase IV -
H1D11_RS21790 4581182..4581967 - 786 WP_000207556.1 putative lateral flagellar export/assembly protein LafU -
H1D11_RS21795 4581939..4583651 + 1713 Protein_4251 flagellar biosynthesis protein FlhA -
H1D11_RS21800 4583749..4584498 - 750 WP_000093946.1 C40 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 4508309..4580004 71695


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T289206 WP_001521903.1 NZ_LR778147:c4579708-4579310 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT289206 WP_000554758.1 NZ_LR778147:c4580004-4579711 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References