Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1143552..1144351 | Replicon | chromosome |
| Accession | NZ_LR778147 | ||
| Organism | Escherichia coli isolate SC418 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A1M2ER85 |
| Locus tag | H1D11_RS05285 | Protein ID | WP_032352641.1 |
| Coordinates | 1143552..1144016 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A1M2ER73 |
| Locus tag | H1D11_RS05290 | Protein ID | WP_032352640.1 |
| Coordinates | 1144016..1144351 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D11_RS05255 | 1138553..1138987 | - | 435 | WP_000948818.1 | PTS sugar transporter subunit IIA | - |
| H1D11_RS05260 | 1139005..1139883 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| H1D11_RS05265 | 1139873..1140652 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| H1D11_RS05270 | 1140663..1141136 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| H1D11_RS05275 | 1141159..1142439 | - | 1281 | WP_032352643.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| H1D11_RS05280 | 1142688..1143497 | + | 810 | WP_096131879.1 | aga operon transcriptional regulator AgaR | - |
| H1D11_RS05285 | 1143552..1144016 | - | 465 | WP_032352641.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| H1D11_RS05290 | 1144016..1144351 | - | 336 | WP_032352640.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| H1D11_RS05295 | 1144500..1146071 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
| H1D11_RS05300 | 1146446..1147780 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| H1D11_RS05305 | 1147796..1148566 | + | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1143552..1154840 | 11288 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17814.20 Da Isoelectric Point: 9.4942
>T289192 WP_032352641.1 NZ_LR778147:c1144016-1143552 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2ER85 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2ER73 |