Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4553328..4554055 | Replicon | chromosome |
| Accession | NZ_LR778146 | ||
| Organism | Escherichia coli isolate SC455 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | H1D08_RS22025 | Protein ID | WP_000547555.1 |
| Coordinates | 4553328..4553639 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | H1D08_RS22030 | Protein ID | WP_175058728.1 |
| Coordinates | 4553636..4554055 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D08_RS21995 | 4548472..4550181 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| H1D08_RS22000 | 4550191..4550733 | + | 543 | WP_000493799.1 | formate hydrogenlyase subunit HycF | - |
| H1D08_RS22005 | 4550733..4551500 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| H1D08_RS22010 | 4551497..4551907 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| H1D08_RS22015 | 4551900..4552367 | + | 468 | WP_000132953.1 | hydrogenase maturation peptidase HycI | - |
| H1D08_RS22020 | 4552410..4553165 | + | 756 | WP_175058766.1 | hypothetical protein | - |
| H1D08_RS22025 | 4553328..4553639 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| H1D08_RS22030 | 4553636..4554055 | + | 420 | WP_175058728.1 | helix-turn-helix domain-containing protein | Antitoxin |
| H1D08_RS22035 | 4554147..4554575 | - | 429 | WP_000536064.1 | hypothetical protein | - |
| H1D08_RS22040 | 4554960..4555487 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
| H1D08_RS22045 | 4555640..4557892 | + | 2253 | WP_175058730.1 | carbamoyltransferase HypF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T289187 WP_000547555.1 NZ_LR778146:4553328-4553639 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15504.48 Da Isoelectric Point: 4.3961
>AT289187 WP_175058728.1 NZ_LR778146:4553636-4554055 [Escherichia coli]
MTANAERAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAERAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|