Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3677195..3677417 | Replicon | chromosome |
| Accession | NZ_LR778146 | ||
| Organism | Escherichia coli isolate SC455 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | H1D08_RS17800 | Protein ID | WP_001295224.1 |
| Coordinates | 3677310..3677417 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3677195..3677261 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D08_RS17770 | 3672199..3673212 | + | 1014 | WP_053898372.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| H1D08_RS17775 | 3673437..3673760 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
| H1D08_RS17780 | 3673745..3674056 | + | 312 | WP_001490601.1 | HipA N-terminal domain-containing protein | - |
| H1D08_RS17785 | 3674056..3675063 | + | 1008 | WP_024225716.1 | HipA domain-containing protein | - |
| H1D08_RS17790 | 3675080..3676351 | - | 1272 | WP_001312176.1 | amino acid permease | - |
| H1D08_RS17795 | 3676827..3676934 | + | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3677195..3677261 | - | 67 | - | - | Antitoxin |
| H1D08_RS17800 | 3677310..3677417 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| H1D08_RS17805 | 3677503..3679182 | - | 1680 | WP_000191568.1 | cellulose biosynthesis protein BcsG | - |
| H1D08_RS17810 | 3679179..3679370 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| H1D08_RS17815 | 3679367..3680938 | - | 1572 | WP_175058660.1 | cellulose biosynthesis protein BcsE | - |
| H1D08_RS17820 | 3681211..3681399 | + | 189 | WP_001063314.1 | YhjR family protein | - |
| H1D08_RS17825 | 3681411..3682163 | + | 753 | WP_175058661.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T289181 WP_001295224.1 NZ_LR778146:3677310-3677417 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT289181 NZ_LR778146:c3677261-3677195 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|