Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2366242..2366936 | Replicon | chromosome |
| Accession | NZ_LR778146 | ||
| Organism | Escherichia coli isolate SC455 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | H1D08_RS11635 | Protein ID | WP_001263500.1 |
| Coordinates | 2366242..2366640 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | H1D08_RS11640 | Protein ID | WP_000554758.1 |
| Coordinates | 2366643..2366936 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D08_RS11610 | 2361551..2362009 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| H1D08_RS11615 | 2362270..2363727 | + | 1458 | WP_175058567.1 | cytosol nonspecific dipeptidase | - |
| H1D08_RS11620 | 2363784..2364398 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| H1D08_RS11625 | 2364395..2365534 | - | 1140 | WP_180344730.1 | RNA ligase RtcB family protein | - |
| H1D08_RS11630 | 2365780..2366232 | - | 453 | WP_089573738.1 | GNAT family N-acetyltransferase | - |
| H1D08_RS11635 | 2366242..2366640 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| H1D08_RS11640 | 2366643..2366936 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| H1D08_RS11645 | 2366988..2368043 | - | 1056 | WP_001226166.1 | DNA polymerase IV | - |
| H1D08_RS11650 | 2368114..2369037 | - | 924 | WP_060578024.1 | putative lateral flagellar export/assembly protein LafU | - |
| H1D08_RS11655 | 2369040..2369903 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| H1D08_RS11660 | 2369916..2370632 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| H1D08_RS11665 | 2370652..2371119 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T289176 WP_001263500.1 NZ_LR778146:c2366640-2366242 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|