Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4269538..4269758 Replicon chromosome
Accession NZ_LR778143
Organism Escherichia coli isolate SC422

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag H1C98_RS20485 Protein ID WP_000170965.1
Coordinates 4269651..4269758 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4269538..4269604 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1C98_RS20460 4264817..4266211 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
H1C98_RS20465 4266396..4266749 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
H1C98_RS20470 4266793..4267488 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H1C98_RS20475 4267646..4267876 - 231 WP_001146442.1 putative cation transport regulator ChaB -
H1C98_RS20480 4268146..4269246 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4269538..4269604 - 67 - - Antitoxin
H1C98_RS20485 4269651..4269758 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4270071..4270134 - 64 NuclAT_33 - -
- 4270071..4270134 - 64 NuclAT_33 - -
- 4270071..4270134 - 64 NuclAT_33 - -
- 4270071..4270134 - 64 NuclAT_33 - -
- 4270071..4270134 - 64 NuclAT_36 - -
- 4270071..4270134 - 64 NuclAT_36 - -
- 4270071..4270134 - 64 NuclAT_36 - -
- 4270071..4270134 - 64 NuclAT_36 - -
- 4270071..4270134 - 64 NuclAT_39 - -
- 4270071..4270134 - 64 NuclAT_39 - -
- 4270071..4270134 - 64 NuclAT_39 - -
- 4270071..4270134 - 64 NuclAT_39 - -
- 4270071..4270134 - 64 NuclAT_42 - -
- 4270071..4270134 - 64 NuclAT_42 - -
- 4270071..4270134 - 64 NuclAT_42 - -
- 4270071..4270134 - 64 NuclAT_42 - -
- 4270071..4270134 - 64 NuclAT_45 - -
- 4270071..4270134 - 64 NuclAT_45 - -
- 4270071..4270134 - 64 NuclAT_45 - -
- 4270071..4270134 - 64 NuclAT_45 - -
- 4270071..4270134 - 64 NuclAT_48 - -
- 4270071..4270134 - 64 NuclAT_48 - -
- 4270071..4270134 - 64 NuclAT_48 - -
- 4270071..4270134 - 64 NuclAT_48 - -
- 4270072..4270134 - 63 NuclAT_50 - -
- 4270072..4270134 - 63 NuclAT_50 - -
- 4270072..4270134 - 63 NuclAT_50 - -
- 4270072..4270134 - 63 NuclAT_50 - -
- 4270072..4270134 - 63 NuclAT_53 - -
- 4270072..4270134 - 63 NuclAT_53 - -
- 4270072..4270134 - 63 NuclAT_53 - -
- 4270072..4270134 - 63 NuclAT_53 - -
- 4270072..4270134 - 63 NuclAT_56 - -
- 4270072..4270134 - 63 NuclAT_56 - -
- 4270072..4270134 - 63 NuclAT_56 - -
- 4270072..4270134 - 63 NuclAT_56 - -
- 4270073..4270134 - 62 NuclAT_15 - -
- 4270073..4270134 - 62 NuclAT_15 - -
- 4270073..4270134 - 62 NuclAT_15 - -
- 4270073..4270134 - 62 NuclAT_15 - -
- 4270073..4270134 - 62 NuclAT_18 - -
- 4270073..4270134 - 62 NuclAT_18 - -
- 4270073..4270134 - 62 NuclAT_18 - -
- 4270073..4270134 - 62 NuclAT_18 - -
- 4270073..4270134 - 62 NuclAT_21 - -
- 4270073..4270134 - 62 NuclAT_21 - -
- 4270073..4270134 - 62 NuclAT_21 - -
- 4270073..4270134 - 62 NuclAT_21 - -
- 4270073..4270134 - 62 NuclAT_24 - -
- 4270073..4270134 - 62 NuclAT_24 - -
- 4270073..4270134 - 62 NuclAT_24 - -
- 4270073..4270134 - 62 NuclAT_24 - -
- 4270073..4270134 - 62 NuclAT_27 - -
- 4270073..4270134 - 62 NuclAT_27 - -
- 4270073..4270134 - 62 NuclAT_27 - -
- 4270073..4270134 - 62 NuclAT_27 - -
- 4270073..4270134 - 62 NuclAT_30 - -
- 4270073..4270134 - 62 NuclAT_30 - -
- 4270073..4270134 - 62 NuclAT_30 - -
- 4270073..4270134 - 62 NuclAT_30 - -
H1C98_RS20490 4270187..4270294 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4270607..4270672 - 66 NuclAT_32 - -
- 4270607..4270672 - 66 NuclAT_32 - -
- 4270607..4270672 - 66 NuclAT_32 - -
- 4270607..4270672 - 66 NuclAT_32 - -
- 4270607..4270672 - 66 NuclAT_35 - -
- 4270607..4270672 - 66 NuclAT_35 - -
- 4270607..4270672 - 66 NuclAT_35 - -
- 4270607..4270672 - 66 NuclAT_35 - -
- 4270607..4270672 - 66 NuclAT_38 - -
- 4270607..4270672 - 66 NuclAT_38 - -
- 4270607..4270672 - 66 NuclAT_38 - -
- 4270607..4270672 - 66 NuclAT_38 - -
- 4270607..4270672 - 66 NuclAT_41 - -
- 4270607..4270672 - 66 NuclAT_41 - -
- 4270607..4270672 - 66 NuclAT_41 - -
- 4270607..4270672 - 66 NuclAT_41 - -
- 4270607..4270672 - 66 NuclAT_44 - -
- 4270607..4270672 - 66 NuclAT_44 - -
- 4270607..4270672 - 66 NuclAT_44 - -
- 4270607..4270672 - 66 NuclAT_44 - -
- 4270607..4270672 - 66 NuclAT_47 - -
- 4270607..4270672 - 66 NuclAT_47 - -
- 4270607..4270672 - 66 NuclAT_47 - -
- 4270607..4270672 - 66 NuclAT_47 - -
- 4270608..4270674 - 67 NuclAT_49 - -
- 4270608..4270674 - 67 NuclAT_49 - -
- 4270608..4270674 - 67 NuclAT_49 - -
- 4270608..4270674 - 67 NuclAT_49 - -
- 4270608..4270674 - 67 NuclAT_52 - -
- 4270608..4270674 - 67 NuclAT_52 - -
- 4270608..4270674 - 67 NuclAT_52 - -
- 4270608..4270674 - 67 NuclAT_52 - -
- 4270608..4270674 - 67 NuclAT_55 - -
- 4270608..4270674 - 67 NuclAT_55 - -
- 4270608..4270674 - 67 NuclAT_55 - -
- 4270608..4270674 - 67 NuclAT_55 - -
- 4270609..4270672 - 64 NuclAT_14 - -
- 4270609..4270672 - 64 NuclAT_14 - -
- 4270609..4270672 - 64 NuclAT_14 - -
- 4270609..4270672 - 64 NuclAT_14 - -
- 4270609..4270672 - 64 NuclAT_17 - -
- 4270609..4270672 - 64 NuclAT_17 - -
- 4270609..4270672 - 64 NuclAT_17 - -
- 4270609..4270672 - 64 NuclAT_17 - -
- 4270609..4270672 - 64 NuclAT_20 - -
- 4270609..4270672 - 64 NuclAT_20 - -
- 4270609..4270672 - 64 NuclAT_20 - -
- 4270609..4270672 - 64 NuclAT_20 - -
- 4270609..4270672 - 64 NuclAT_23 - -
- 4270609..4270672 - 64 NuclAT_23 - -
- 4270609..4270672 - 64 NuclAT_23 - -
- 4270609..4270672 - 64 NuclAT_23 - -
- 4270609..4270672 - 64 NuclAT_26 - -
- 4270609..4270672 - 64 NuclAT_26 - -
- 4270609..4270672 - 64 NuclAT_26 - -
- 4270609..4270672 - 64 NuclAT_26 - -
- 4270609..4270672 - 64 NuclAT_29 - -
- 4270609..4270672 - 64 NuclAT_29 - -
- 4270609..4270672 - 64 NuclAT_29 - -
- 4270609..4270672 - 64 NuclAT_29 - -
H1C98_RS20495 4270722..4270829 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
H1C98_RS20500 4270978..4271832 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H1C98_RS20505 4271868..4272677 - 810 WP_001257044.1 invasion regulator SirB1 -
H1C98_RS20510 4272681..4273073 - 393 WP_000200392.1 invasion regulator SirB2 -
H1C98_RS20515 4273070..4273903 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T289152 WP_000170965.1 NZ_LR778143:4269651-4269758 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT289152 NZ_LR778143:c4269604-4269538 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References