Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 4110315..4111633 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | - |
Locus tag | H1D10_RS20010 | Protein ID | WP_024225716.1 |
Coordinates | 4110315..4111322 (-) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A2A7M399 |
Locus tag | H1D10_RS20015 | Protein ID | WP_001490601.1 |
Coordinates | 4111322..4111633 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS19985 | 4106008..4106199 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
H1D10_RS19990 | 4106196..4107875 | + | 1680 | WP_000191568.1 | cellulose biosynthesis protein BcsG | - |
H1D10_RS19995 | 4107961..4108068 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
H1D10_RS20000 | 4108444..4108551 | - | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
H1D10_RS20005 | 4109027..4110298 | + | 1272 | WP_001312176.1 | amino acid permease | - |
H1D10_RS20010 | 4110315..4111322 | - | 1008 | WP_024225716.1 | HipA domain-containing protein | Toxin |
H1D10_RS20015 | 4111322..4111633 | - | 312 | WP_001490601.1 | HipA N-terminal domain-containing protein | Antitoxin |
H1D10_RS20020 | 4111618..4111941 | - | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
H1D10_RS20025 | 4112166..4113179 | - | 1014 | WP_053898372.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
H1D10_RS20030 | 4113176..4114159 | - | 984 | WP_112886706.1 | dipeptide ABC transporter ATP-binding protein | - |
H1D10_RS20035 | 4114170..4115072 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
H1D10_RS20040 | 4115082..4116101 | - | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38384.63 Da Isoelectric Point: 5.6166
>T289129 WP_024225716.1 NZ_LR778142:c4111322-4110315 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLNEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVSVHGLLSFAPQSEEELEYAFVIRRYDRDYKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPTLAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLNEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVSVHGLLSFAPQSEEELEYAFVIRRYDRDYKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPTLAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|