Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4108444..4108666 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7UL94 |
Locus tag | H1D10_RS20000 | Protein ID | WP_000170747.1 |
Coordinates | 4108444..4108551 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4108600..4108666 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS19975 | 4103979..4104167 | - | 189 | WP_001063314.1 | YhjR family protein | - |
H1D10_RS19980 | 4104440..4106011 | + | 1572 | WP_175058660.1 | cellulose biosynthesis protein BcsE | - |
H1D10_RS19985 | 4106008..4106199 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
H1D10_RS19990 | 4106196..4107875 | + | 1680 | WP_000191568.1 | cellulose biosynthesis protein BcsG | - |
H1D10_RS19995 | 4107961..4108068 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
H1D10_RS20000 | 4108444..4108551 | - | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4108600..4108666 | + | 67 | - | - | Antitoxin |
H1D10_RS20005 | 4109027..4110298 | + | 1272 | WP_001312176.1 | amino acid permease | - |
H1D10_RS20010 | 4110315..4111322 | - | 1008 | WP_024225716.1 | HipA domain-containing protein | - |
H1D10_RS20015 | 4111322..4111633 | - | 312 | WP_001490601.1 | HipA N-terminal domain-containing protein | - |
H1D10_RS20020 | 4111618..4111941 | - | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
H1D10_RS20025 | 4112166..4113179 | - | 1014 | WP_053898372.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3910.76 Da Isoelectric Point: 9.0157
>T289128 WP_000170747.1 NZ_LR778142:c4108551-4108444 [Escherichia coli]
MTLAELGMAFWHDLAVPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAVPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT289128 NZ_LR778142:4108600-4108666 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|