Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3683266..3684065 | Replicon | chromosome |
| Accession | NZ_LR778142 | ||
| Organism | Escherichia coli isolate SC434 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | H1D10_RS17885 | Protein ID | WP_087598199.1 |
| Coordinates | 3683601..3684065 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | H1D10_RS17880 | Protein ID | WP_087598198.1 |
| Coordinates | 3683266..3683601 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D10_RS17865 | 3679051..3679821 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| H1D10_RS17870 | 3679837..3681171 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| H1D10_RS17875 | 3681546..3683117 | + | 1572 | WP_001273940.1 | galactarate dehydratase | - |
| H1D10_RS17880 | 3683266..3683601 | + | 336 | WP_087598198.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| H1D10_RS17885 | 3683601..3684065 | + | 465 | WP_087598199.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| H1D10_RS17890 | 3684120..3684929 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| H1D10_RS17895 | 3685178..3686458 | + | 1281 | WP_137527028.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| H1D10_RS17900 | 3686481..3686954 | + | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| H1D10_RS17905 | 3686965..3687744 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| H1D10_RS17910 | 3687734..3688612 | + | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| H1D10_RS17915 | 3688630..3689064 | + | 435 | WP_137527029.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17811.16 Da Isoelectric Point: 9.4947
>T289125 WP_087598199.1 NZ_LR778142:3683601-3684065 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|