Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3231387..3232114 | Replicon | chromosome |
| Accession | NZ_LR778142 | ||
| Organism | Escherichia coli isolate SC434 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | H1D10_RS15770 | Protein ID | WP_000547555.1 |
| Coordinates | 3231803..3232114 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | H1D10_RS15765 | Protein ID | WP_175058728.1 |
| Coordinates | 3231387..3231806 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D10_RS15750 | 3227550..3229802 | - | 2253 | WP_175058730.1 | carbamoyltransferase HypF | - |
| H1D10_RS15755 | 3229955..3230482 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| H1D10_RS15760 | 3230867..3231295 | + | 429 | WP_000536064.1 | hypothetical protein | - |
| H1D10_RS15765 | 3231387..3231806 | - | 420 | WP_175058728.1 | helix-turn-helix domain-containing protein | Antitoxin |
| H1D10_RS15770 | 3231803..3232114 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| H1D10_RS15775 | 3232277..3233032 | - | 756 | WP_175058766.1 | hypothetical protein | - |
| H1D10_RS15780 | 3233075..3233542 | - | 468 | WP_000132953.1 | hydrogenase maturation peptidase HycI | - |
| H1D10_RS15785 | 3233535..3233945 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| H1D10_RS15790 | 3233942..3234709 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| H1D10_RS15795 | 3234709..3235251 | - | 543 | WP_000493799.1 | formate hydrogenlyase subunit HycF | - |
| H1D10_RS15800 | 3235261..3236970 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T289122 WP_000547555.1 NZ_LR778142:c3232114-3231803 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15504.48 Da Isoelectric Point: 4.3961
>AT289122 WP_175058728.1 NZ_LR778142:c3231806-3231387 [Escherichia coli]
MTANAERAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAERAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|