Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 760219..760913 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | H1D10_RS03580 | Protein ID | WP_001263500.1 |
Coordinates | 760515..760913 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | H1D10_RS03575 | Protein ID | WP_000554758.1 |
Coordinates | 760219..760512 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS03550 | 756036..756503 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
H1D10_RS03555 | 756523..757239 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
H1D10_RS03560 | 757252..758115 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
H1D10_RS03565 | 758118..759041 | + | 924 | WP_060578024.1 | putative lateral flagellar export/assembly protein LafU | - |
H1D10_RS03570 | 759112..760167 | + | 1056 | WP_001226166.1 | DNA polymerase IV | - |
H1D10_RS03575 | 760219..760512 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
H1D10_RS03580 | 760515..760913 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
H1D10_RS03585 | 760923..761375 | + | 453 | WP_089573738.1 | GNAT family N-acetyltransferase | - |
H1D10_RS03590 | 761621..762760 | + | 1140 | WP_180344730.1 | RNA ligase RtcB family protein | - |
H1D10_RS03595 | 762757..763371 | + | 615 | WP_000602123.1 | peptide chain release factor H | - |
H1D10_RS03600 | 763428..764885 | - | 1458 | WP_175058567.1 | cytosol nonspecific dipeptidase | - |
H1D10_RS03605 | 765146..765604 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T289113 WP_001263500.1 NZ_LR778142:760515-760913 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|