Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 758928..759148 Replicon chromosome
Accession NZ_LR778141
Organism Escherichia coli isolate SC407

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag H1C92_RS03755 Protein ID WP_000170965.1
Coordinates 758928..759035 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 759082..759148 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1C92_RS03725 754782..755615 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
H1C92_RS03730 755612..756004 + 393 WP_000200392.1 invasion regulator SirB2 -
H1C92_RS03735 756008..756818 + 811 Protein_727 tetratricopeptide repeat-containing protein -
H1C92_RS03740 756854..757708 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H1C92_RS03745 757857..757964 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 758012..758078 + 67 NuclAT_49 - -
- 758012..758078 + 67 NuclAT_49 - -
- 758012..758078 + 67 NuclAT_49 - -
- 758012..758078 + 67 NuclAT_49 - -
- 758012..758078 + 67 NuclAT_52 - -
- 758012..758078 + 67 NuclAT_52 - -
- 758012..758078 + 67 NuclAT_52 - -
- 758012..758078 + 67 NuclAT_52 - -
- 758012..758078 + 67 NuclAT_55 - -
- 758012..758078 + 67 NuclAT_55 - -
- 758012..758078 + 67 NuclAT_55 - -
- 758012..758078 + 67 NuclAT_55 - -
- 758014..758077 + 64 NuclAT_14 - -
- 758014..758077 + 64 NuclAT_14 - -
- 758014..758077 + 64 NuclAT_14 - -
- 758014..758077 + 64 NuclAT_14 - -
- 758014..758077 + 64 NuclAT_17 - -
- 758014..758077 + 64 NuclAT_17 - -
- 758014..758077 + 64 NuclAT_17 - -
- 758014..758077 + 64 NuclAT_17 - -
- 758014..758077 + 64 NuclAT_20 - -
- 758014..758077 + 64 NuclAT_20 - -
- 758014..758077 + 64 NuclAT_20 - -
- 758014..758077 + 64 NuclAT_20 - -
- 758014..758077 + 64 NuclAT_23 - -
- 758014..758077 + 64 NuclAT_23 - -
- 758014..758077 + 64 NuclAT_23 - -
- 758014..758077 + 64 NuclAT_23 - -
- 758014..758077 + 64 NuclAT_26 - -
- 758014..758077 + 64 NuclAT_26 - -
- 758014..758077 + 64 NuclAT_26 - -
- 758014..758077 + 64 NuclAT_26 - -
- 758014..758077 + 64 NuclAT_29 - -
- 758014..758077 + 64 NuclAT_29 - -
- 758014..758077 + 64 NuclAT_29 - -
- 758014..758077 + 64 NuclAT_29 - -
- 758014..758079 + 66 NuclAT_32 - -
- 758014..758079 + 66 NuclAT_32 - -
- 758014..758079 + 66 NuclAT_32 - -
- 758014..758079 + 66 NuclAT_32 - -
- 758014..758079 + 66 NuclAT_35 - -
- 758014..758079 + 66 NuclAT_35 - -
- 758014..758079 + 66 NuclAT_35 - -
- 758014..758079 + 66 NuclAT_35 - -
- 758014..758079 + 66 NuclAT_38 - -
- 758014..758079 + 66 NuclAT_38 - -
- 758014..758079 + 66 NuclAT_38 - -
- 758014..758079 + 66 NuclAT_38 - -
- 758014..758079 + 66 NuclAT_41 - -
- 758014..758079 + 66 NuclAT_41 - -
- 758014..758079 + 66 NuclAT_41 - -
- 758014..758079 + 66 NuclAT_41 - -
- 758014..758079 + 66 NuclAT_44 - -
- 758014..758079 + 66 NuclAT_44 - -
- 758014..758079 + 66 NuclAT_44 - -
- 758014..758079 + 66 NuclAT_44 - -
- 758014..758079 + 66 NuclAT_47 - -
- 758014..758079 + 66 NuclAT_47 - -
- 758014..758079 + 66 NuclAT_47 - -
- 758014..758079 + 66 NuclAT_47 - -
H1C92_RS03750 758392..758499 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 758552..758613 + 62 NuclAT_15 - -
- 758552..758613 + 62 NuclAT_15 - -
- 758552..758613 + 62 NuclAT_15 - -
- 758552..758613 + 62 NuclAT_15 - -
- 758552..758613 + 62 NuclAT_18 - -
- 758552..758613 + 62 NuclAT_18 - -
- 758552..758613 + 62 NuclAT_18 - -
- 758552..758613 + 62 NuclAT_18 - -
- 758552..758613 + 62 NuclAT_21 - -
- 758552..758613 + 62 NuclAT_21 - -
- 758552..758613 + 62 NuclAT_21 - -
- 758552..758613 + 62 NuclAT_21 - -
- 758552..758613 + 62 NuclAT_24 - -
- 758552..758613 + 62 NuclAT_24 - -
- 758552..758613 + 62 NuclAT_24 - -
- 758552..758613 + 62 NuclAT_24 - -
- 758552..758613 + 62 NuclAT_27 - -
- 758552..758613 + 62 NuclAT_27 - -
- 758552..758613 + 62 NuclAT_27 - -
- 758552..758613 + 62 NuclAT_27 - -
- 758552..758613 + 62 NuclAT_30 - -
- 758552..758613 + 62 NuclAT_30 - -
- 758552..758613 + 62 NuclAT_30 - -
- 758552..758613 + 62 NuclAT_30 - -
- 758552..758614 + 63 NuclAT_50 - -
- 758552..758614 + 63 NuclAT_50 - -
- 758552..758614 + 63 NuclAT_50 - -
- 758552..758614 + 63 NuclAT_50 - -
- 758552..758614 + 63 NuclAT_53 - -
- 758552..758614 + 63 NuclAT_53 - -
- 758552..758614 + 63 NuclAT_53 - -
- 758552..758614 + 63 NuclAT_53 - -
- 758552..758614 + 63 NuclAT_56 - -
- 758552..758614 + 63 NuclAT_56 - -
- 758552..758614 + 63 NuclAT_56 - -
- 758552..758614 + 63 NuclAT_56 - -
- 758552..758615 + 64 NuclAT_33 - -
- 758552..758615 + 64 NuclAT_33 - -
- 758552..758615 + 64 NuclAT_33 - -
- 758552..758615 + 64 NuclAT_33 - -
- 758552..758615 + 64 NuclAT_36 - -
- 758552..758615 + 64 NuclAT_36 - -
- 758552..758615 + 64 NuclAT_36 - -
- 758552..758615 + 64 NuclAT_36 - -
- 758552..758615 + 64 NuclAT_39 - -
- 758552..758615 + 64 NuclAT_39 - -
- 758552..758615 + 64 NuclAT_39 - -
- 758552..758615 + 64 NuclAT_39 - -
- 758552..758615 + 64 NuclAT_42 - -
- 758552..758615 + 64 NuclAT_42 - -
- 758552..758615 + 64 NuclAT_42 - -
- 758552..758615 + 64 NuclAT_42 - -
- 758552..758615 + 64 NuclAT_45 - -
- 758552..758615 + 64 NuclAT_45 - -
- 758552..758615 + 64 NuclAT_45 - -
- 758552..758615 + 64 NuclAT_45 - -
- 758552..758615 + 64 NuclAT_48 - -
- 758552..758615 + 64 NuclAT_48 - -
- 758552..758615 + 64 NuclAT_48 - -
- 758552..758615 + 64 NuclAT_48 - -
H1C92_RS03755 758928..759035 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 759082..759148 + 67 - - Antitoxin
H1C92_RS03760 759440..760540 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
H1C92_RS03765 760810..761040 + 231 WP_001146442.1 putative cation transport regulator ChaB -
H1C92_RS03770 761198..761893 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
H1C92_RS03775 761937..762290 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
H1C92_RS03780 762475..763869 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T289087 WP_000170965.1 NZ_LR778141:c759035-758928 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT289087 NZ_LR778141:759082-759148 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References