Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4820033..4820635 | Replicon | chromosome |
Accession | NZ_LR778140 | ||
Organism | Escherichia coli isolate SC406 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | H1C94_RS23080 | Protein ID | WP_000897305.1 |
Coordinates | 4820324..4820635 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | H1C94_RS23075 | Protein ID | WP_000356397.1 |
Coordinates | 4820033..4820323 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C94_RS23050 | 4815958..4816860 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
H1C94_RS23055 | 4816857..4817492 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
H1C94_RS23060 | 4817489..4818418 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
H1C94_RS23065 | 4818748..4818990 | - | 243 | WP_001087409.1 | hypothetical protein | - |
H1C94_RS23070 | 4819210..4819428 | - | 219 | WP_001315930.1 | ribbon-helix-helix domain-containing protein | - |
H1C94_RS23075 | 4820033..4820323 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
H1C94_RS23080 | 4820324..4820635 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
H1C94_RS23085 | 4820864..4821772 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
H1C94_RS23090 | 4821836..4822777 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
H1C94_RS23095 | 4822822..4823259 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
H1C94_RS23100 | 4823256..4824128 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
H1C94_RS23105 | 4824122..4824721 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
H1C94_RS23110 | 4824820..4825605 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T289082 WP_000897305.1 NZ_LR778140:c4820635-4820324 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|