Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 62633..62887 | Replicon | 1 day old chicken plasmid pAPEC2908 |
Accession | NZ_LR740777 | ||
Organism | Escherichia coli strain BEN2908 isolate |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | APEC2908_RS25050 | Protein ID | WP_001351576.1 |
Coordinates | 62633..62839 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 62826..62887 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC2908_RS25015 | 57708..58384 | + | 677 | Protein_52 | transposase | - |
APEC2908_RS25020 | 58384..58730 | + | 347 | Protein_53 | IS66 family insertion sequence element accessory protein TnpB | - |
APEC2908_RS25025 | 58750..60313 | + | 1564 | Protein_54 | IS66 family transposase | - |
APEC2908_RS25030 | 60461..61318 | - | 858 | WP_161476334.1 | incFII family plasmid replication initiator RepA | - |
APEC2908_RS25035 | 61311..61793 | - | 483 | WP_001273588.1 | hypothetical protein | - |
APEC2908_RS25040 | 61786..61860 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
APEC2908_RS25045 | 62092..62349 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
APEC2908_RS25050 | 62633..62839 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 62826..62887 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 62826..62887 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 62826..62887 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 62826..62887 | + | 62 | NuclAT_1 | - | Antitoxin |
APEC2908_RS25055 | 63143..63217 | - | 75 | Protein_60 | endonuclease | - |
APEC2908_RS25060 | 63463..63675 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
APEC2908_RS25065 | 63811..64371 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
APEC2908_RS25070 | 64474..65334 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
APEC2908_RS25075 | 65393..66139 | - | 747 | WP_021512286.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..152011 | 152011 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T289014 WP_001351576.1 NZ_LR740777:c62839-62633 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 62 bp
>AT289014 NZ_LR740777:62826-62887 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|