Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4307033..4307635 | Replicon | chromosome |
Accession | NZ_LR740776 | ||
Organism | Escherichia coli strain BEN2908 isolate |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | APEC2908_RS21065 | Protein ID | WP_000897302.1 |
Coordinates | 4307033..4307344 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | APEC2908_RS21070 | Protein ID | WP_000356397.1 |
Coordinates | 4307345..4307635 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC2908_RS21040 | 4302947..4303546 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
APEC2908_RS21045 | 4303540..4304412 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
APEC2908_RS21050 | 4304409..4304846 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
APEC2908_RS21055 | 4304891..4305832 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
APEC2908_RS21060 | 4305896..4306804 | - | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
APEC2908_RS21065 | 4307033..4307344 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
APEC2908_RS21070 | 4307345..4307635 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
APEC2908_RS21075 | 4307994..4308272 | + | 279 | WP_001296612.1 | hypothetical protein | - |
APEC2908_RS21080 | 4308668..4308886 | + | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
APEC2908_RS21085 | 4309102..4310031 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
APEC2908_RS21090 | 4310028..4310663 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
APEC2908_RS21095 | 4310660..4311562 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T289009 WP_000897302.1 NZ_LR740776:4307033-4307344 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|