Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 15454..15712 | Replicon | chromosome |
| Accession | NZ_LR740776 | ||
| Organism | Escherichia coli strain BEN2908 isolate | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | APEC2908_RS00075 | Protein ID | WP_000809168.1 |
| Coordinates | 15454..15606 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 15655..15712 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC2908_RS00055 | 10699..11412 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
| APEC2908_RS00060 | 11438..11842 | - | 405 | WP_000843687.1 | DUF2541 family protein | - |
| APEC2908_RS00065 | 12214..14130 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| APEC2908_RS00070 | 14219..15349 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| APEC2908_RS00075 | 15454..15606 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 15655..15712 | + | 58 | - | - | Antitoxin |
| APEC2908_RS00080 | 16218..16979 | + | 762 | WP_001274823.1 | hypothetical protein | - |
| APEC2908_RS00085 | 16999..18492 | + | 1494 | WP_001350775.1 | sulfatase-like hydrolase/transferase | - |
| APEC2908_RS00090 | 18621..19880 | + | 1260 | WP_000494924.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T288993 WP_000809168.1 NZ_LR740776:c15606-15454 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT288993 NZ_LR740776:15655-15712 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|