Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51993..52410 | Replicon | plasmid pbAPEC5202 |
| Accession | NZ_LR740760 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | APEC5202_RS26335 | Protein ID | WP_001312861.1 |
| Coordinates | 52252..52410 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 51993..52187 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS26650 | 47252..47635 | + | 384 | WP_162542035.1 | hypothetical protein | - |
| APEC5202_RS26310 | 48012..48464 | + | 453 | WP_103530050.1 | single-stranded DNA-binding protein | - |
| APEC5202_RS26315 | 48526..48759 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| APEC5202_RS26320 | 48818..50776 | + | 1959 | WP_141088311.1 | ParB/RepB/Spo0J family partition protein | - |
| APEC5202_RS26325 | 50831..51265 | + | 435 | WP_123004679.1 | conjugation system SOS inhibitor PsiB | - |
| APEC5202_RS26330 | 51262..51981 | + | 720 | WP_029490503.1 | plasmid SOS inhibition protein A | - |
| - | 51993..52187 | + | 195 | NuclAT_0 | - | Antitoxin |
| - | 51993..52187 | + | 195 | NuclAT_0 | - | Antitoxin |
| - | 51993..52187 | + | 195 | NuclAT_0 | - | Antitoxin |
| - | 51993..52187 | + | 195 | NuclAT_0 | - | Antitoxin |
| APEC5202_RS26335 | 52252..52410 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| APEC5202_RS26345 | 53334..53621 | + | 288 | WP_000107526.1 | hypothetical protein | - |
| APEC5202_RS26350 | 53740..54561 | + | 822 | WP_029490175.1 | DUF945 domain-containing protein | - |
| APEC5202_RS26355 | 54857..55504 | - | 648 | WP_141088316.1 | transglycosylase SLT domain-containing protein | - |
| APEC5202_RS26360 | 55790..56173 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
| APEC5202_RS26365 | 56367..57059 | + | 693 | WP_103530060.1 | PAS domain-containing protein | - |
| APEC5202_RS26370 | 57164..57391 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..92214 | 92214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T288989 WP_001312861.1 NZ_LR740760:52252-52410 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 195 bp
>AT288989 NZ_LR740760:51993-52187 [Escherichia coli]
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|