Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 5051584..5051996 | Replicon | chromosome |
Accession | NZ_LR740758 | ||
Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8E0IWC4 |
Locus tag | APEC5202_RS24565 | Protein ID | WP_001513534.1 |
Coordinates | 5051584..5051925 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 5051920..5051996 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC5202_RS24545 | 5046653..5047933 | - | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
APEC5202_RS24550 | 5048118..5049038 | + | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
APEC5202_RS24555 | 5049266..5049346 | + | 81 | WP_020233658.1 | hypothetical protein | - |
APEC5202_RS24560 | 5049381..5051537 | + | 2157 | WP_174235638.1 | DUF262 domain-containing protein | - |
APEC5202_RS24565 | 5051584..5051925 | - | 342 | WP_001513534.1 | endoribonuclease SymE | Toxin |
- | 5051920..5051996 | + | 77 | NuclAT_6 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_6 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_6 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_6 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_7 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_7 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_7 | - | Antitoxin |
- | 5051920..5051996 | + | 77 | NuclAT_7 | - | Antitoxin |
APEC5202_RS24570 | 5052146..5053915 | - | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
APEC5202_RS24575 | 5053915..5055384 | - | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12247.03 Da Isoelectric Point: 7.8545
>T288975 WP_001513534.1 NZ_LR740758:c5051925-5051584 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT288975 NZ_LR740758:5051920-5051996 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|