Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4454604..4455206 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | APEC5202_RS21680 | Protein ID | WP_000897302.1 |
| Coordinates | 4454604..4454915 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | APEC5202_RS21685 | Protein ID | WP_000356397.1 |
| Coordinates | 4454916..4455206 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS21655 | 4450518..4451117 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| APEC5202_RS21660 | 4451111..4451983 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| APEC5202_RS21665 | 4451980..4452417 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| APEC5202_RS21670 | 4452462..4453403 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| APEC5202_RS21675 | 4453467..4454375 | - | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| APEC5202_RS21680 | 4454604..4454915 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| APEC5202_RS21685 | 4454916..4455206 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| APEC5202_RS21690 | 4455565..4455843 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| APEC5202_RS21695 | 4456239..4456457 | + | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
| APEC5202_RS21700 | 4456673..4457602 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| APEC5202_RS21705 | 4457599..4458234 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| APEC5202_RS21710 | 4458231..4459133 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T288971 WP_000897302.1 NZ_LR740758:4454604-4454915 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|