Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3980521..3980743 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | APEC5202_RS19415 | Protein ID | WP_001295224.1 |
| Coordinates | 3980521..3980628 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3980677..3980743 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS19390 | 3976056..3976244 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| APEC5202_RS19395 | 3976517..3978088 | + | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
| APEC5202_RS19400 | 3978085..3978276 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| APEC5202_RS19405 | 3978273..3979952 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| APEC5202_RS19410 | 3980038..3980145 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| APEC5202_RS19415 | 3980521..3980628 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3980677..3980743 | + | 67 | - | - | Antitoxin |
| APEC5202_RS19420 | 3981003..3981110 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| APEC5202_RS19425 | 3981586..3982857 | + | 1272 | WP_001332306.1 | amino acid permease | - |
| APEC5202_RS19430 | 3982887..3983891 | - | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| APEC5202_RS19435 | 3983888..3984871 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T288968 WP_001295224.1 NZ_LR740758:c3980628-3980521 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT288968 NZ_LR740758:3980677-3980743 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|