Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 505096..505775 | Replicon | chromosome |
Accession | NZ_LR740758 | ||
Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | APEC5202_RS02350 | Protein ID | WP_000057524.1 |
Coordinates | 505096..505398 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | APEC5202_RS02355 | Protein ID | WP_000806442.1 |
Coordinates | 505434..505775 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC5202_RS02325 | 500472..502124 | + | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
APEC5202_RS02330 | 502162..502665 | - | 504 | WP_000667000.1 | hypothetical protein | - |
APEC5202_RS02335 | 502662..503462 | - | 801 | Protein_460 | hypothetical protein | - |
APEC5202_RS02340 | 503486..503965 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
APEC5202_RS02345 | 504169..504963 | - | 795 | WP_000365177.1 | TraB/GumN family protein | - |
APEC5202_RS02350 | 505096..505398 | + | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
APEC5202_RS02355 | 505434..505775 | + | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
APEC5202_RS02360 | 505833..508337 | - | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
APEC5202_RS02365 | 508599..509531 | + | 933 | WP_000883052.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 502162..514373 | 12211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T288954 WP_000057524.1 NZ_LR740758:505096-505398 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|