Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 284019..284713 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | APEC5202_RS01305 | Protein ID | WP_001263500.1 |
| Coordinates | 284315..284713 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | APEC5202_RS01300 | Protein ID | WP_000554758.1 |
| Coordinates | 284019..284312 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS01275 | 279555..280052 | + | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
| APEC5202_RS01280 | 280135..280293 | - | 159 | WP_014639450.1 | hypothetical protein | - |
| APEC5202_RS01285 | 280372..282084 | - | 1713 | Protein_252 | flagellar biosynthesis protein FlhA | - |
| APEC5202_RS01290 | 282056..282841 | + | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
| APEC5202_RS01295 | 282912..283967 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| APEC5202_RS01300 | 284019..284312 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| APEC5202_RS01305 | 284315..284713 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| APEC5202_RS01310 | 284723..285175 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| APEC5202_RS01315 | 285365..286504 | + | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| APEC5202_RS01320 | 286501..287115 | + | 615 | WP_000602123.1 | peptide chain release factor H | - |
| APEC5202_RS01325 | 287172..288629 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| APEC5202_RS01330 | 288890..289348 | + | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 264495..285175 | 20680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T288952 WP_001263500.1 NZ_LR740758:284315-284713 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|