Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5420346..5420941 | Replicon | chromosome |
Accession | NZ_LR739071 | ||
Organism | Pseudomonas aeruginosa strain C7-25 isolate C7-25 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PERCYII40_RS25055 | Protein ID | WP_003113526.1 |
Coordinates | 5420663..5420941 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PERCYII40_RS25050 | Protein ID | WP_003113527.1 |
Coordinates | 5420346..5420651 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PERCYII40_RS25015 | 5415483..5416331 | + | 849 | WP_124171302.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PERCYII40_RS25025 | 5416498..5417439 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PERCYII40_RS25030 | 5417556..5418170 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PERCYII40_RS25035 | 5418214..5418798 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PERCYII40_RS25040 | 5418839..5419939 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PERCYII40_RS25050 | 5420346..5420651 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
PERCYII40_RS25055 | 5420663..5420941 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PERCYII40_RS25060 | 5421270..5423498 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PERCYII40_RS25065 | 5423568..5424215 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PERCYII40_RS25070 | 5424277..5425515 | - | 1239 | WP_023084819.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T288949 WP_003113526.1 NZ_LR739071:c5420941-5420663 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|