Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4802796..4803477 | Replicon | chromosome |
| Accession | NZ_LR739071 | ||
| Organism | Pseudomonas aeruginosa strain C7-25 isolate C7-25 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6AKP0 |
| Locus tag | PERCYII40_RS22240 | Protein ID | WP_003111825.1 |
| Coordinates | 4803112..4803477 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PERCYII40_RS22235 | Protein ID | WP_003145733.1 |
| Coordinates | 4802796..4803119 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PERCYII40_RS22210 | 4798709..4799347 | + | 639 | WP_003109444.1 | hypothetical protein | - |
| PERCYII40_RS22215 | 4799590..4799925 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
| PERCYII40_RS22220 | 4800099..4800617 | + | 519 | WP_128654462.1 | PAAR domain-containing protein | - |
| PERCYII40_RS22225 | 4800614..4801315 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
| PERCYII40_RS22230 | 4801332..4802420 | + | 1089 | WP_034025227.1 | DUF3396 domain-containing protein | - |
| PERCYII40_RS22235 | 4802796..4803119 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
| PERCYII40_RS22240 | 4803112..4803477 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PERCYII40_RS22245 | 4803741..4803980 | - | 240 | WP_049876884.1 | hypothetical protein | - |
| PERCYII40_RS22250 | 4804187..4804459 | + | 273 | WP_003085667.1 | hypothetical protein | - |
| PERCYII40_RS22255 | 4804478..4804903 | - | 426 | WP_003114206.1 | ring-cleaving dioxygenase | - |
| PERCYII40_RS22260 | 4805004..4805888 | + | 885 | WP_128654463.1 | LysR family transcriptional regulator | - |
| PERCYII40_RS22265 | 4805861..4806814 | - | 954 | WP_003085661.1 | LysR family transcriptional regulator | - |
| PERCYII40_RS22270 | 4807035..4807469 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T288948 WP_003111825.1 NZ_LR739071:c4803477-4803112 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|