Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5594933..5595528 | Replicon | chromosome |
Accession | NZ_LR739068 | ||
Organism | Pseudomonas aeruginosa strain PcyII-29 isolate PcyII-29 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | G3R42_RS26040 | Protein ID | WP_003113526.1 |
Coordinates | 5595250..5595528 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | G3R42_RS26035 | Protein ID | WP_003099268.1 |
Coordinates | 5594933..5595238 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G3R42_RS26000 | 5590072..5590920 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
G3R42_RS26010 | 5591087..5592028 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
G3R42_RS26015 | 5592145..5592759 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
G3R42_RS26020 | 5592801..5593385 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
G3R42_RS26025 | 5593426..5594526 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
G3R42_RS26035 | 5594933..5595238 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
G3R42_RS26040 | 5595250..5595528 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G3R42_RS26045 | 5595857..5598085 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
G3R42_RS26050 | 5598155..5598802 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
G3R42_RS26055 | 5598864..5600102 | - | 1239 | WP_003099263.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T288934 WP_003113526.1 NZ_LR739068:c5595528-5595250 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|