Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1037659..1038461 | Replicon | chromosome |
Accession | NZ_LR735440 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0711 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | GOZ26_RS05245 | Protein ID | WP_002468490.1 |
Coordinates | 1038282..1038461 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | GOZ26_RS05240 | Protein ID | WP_001829848.1 |
Coordinates | 1037659..1038258 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ26_RS05215 | 1032870..1034327 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
GOZ26_RS05220 | 1034320..1035042 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
GOZ26_RS05225 | 1035557..1035694 | + | 138 | WP_064783702.1 | hypothetical protein | - |
GOZ26_RS05230 | 1035904..1037034 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
GOZ26_RS05235 | 1037031..1037501 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
GOZ26_RS05240 | 1037659..1038258 | + | 600 | WP_001829848.1 | hypothetical protein | Antitoxin |
GOZ26_RS05245 | 1038282..1038461 | + | 180 | WP_002468490.1 | hypothetical protein | Toxin |
GOZ26_RS05250 | 1038617..1039021 | + | 405 | WP_001829818.1 | hypothetical protein | - |
GOZ26_RS05255 | 1039206..1040591 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
GOZ26_RS05260 | 1040952..1041776 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
GOZ26_RS05265 | 1041935..1043068 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1035539..1035694 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T288892 WP_002468490.1 NZ_LR735440:1038282-1038461 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22699.58 Da Isoelectric Point: 4.9942
>AT288892 WP_001829848.1 NZ_LR735440:1037659-1038258 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHASVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHASVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|