Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1020370..1021172 | Replicon | chromosome |
Accession | NZ_LR735434 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0736 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | GOZ11_RS05115 | Protein ID | WP_002468490.1 |
Coordinates | 1020993..1021172 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | GOZ11_RS05110 | Protein ID | WP_155974624.1 |
Coordinates | 1020370..1020969 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ11_RS05085 | 1015581..1017038 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
GOZ11_RS05090 | 1017031..1017753 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
GOZ11_RS05095 | 1018268..1018405 | + | 138 | WP_064783702.1 | hypothetical protein | - |
GOZ11_RS05100 | 1018615..1019745 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
GOZ11_RS05105 | 1019742..1020212 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
GOZ11_RS05110 | 1020370..1020969 | + | 600 | WP_155974624.1 | glucosamine-6-phosphate isomerase | Antitoxin |
GOZ11_RS05115 | 1020993..1021172 | + | 180 | WP_002468490.1 | hypothetical protein | Toxin |
GOZ11_RS05120 | 1021328..1021732 | + | 405 | WP_001829818.1 | hypothetical protein | - |
GOZ11_RS05125 | 1021917..1023302 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
GOZ11_RS05130 | 1023663..1024487 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
GOZ11_RS05135 | 1024646..1025779 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1018250..1018405 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T288884 WP_002468490.1 NZ_LR735434:1020993-1021172 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22708.64 Da Isoelectric Point: 5.1497
>AT288884 WP_155974624.1 NZ_LR735434:1020370-1020969 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISNKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISNKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|