Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1170402..1171204 | Replicon | chromosome |
Accession | NZ_LR735432 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_RP62a-WT |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | GOZ24_RS05870 | Protein ID | WP_002468490.1 |
Coordinates | 1171025..1171204 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | Q5HN82 |
Locus tag | GOZ24_RS05865 | Protein ID | WP_002456349.1 |
Coordinates | 1170402..1171001 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ24_RS05840 | 1165613..1167070 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
GOZ24_RS05845 | 1167063..1167785 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
GOZ24_RS05850 | 1168282..1168437 | + | 156 | WP_001829854.1 | hypothetical protein | - |
GOZ24_RS05855 | 1168647..1169777 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
GOZ24_RS05860 | 1169774..1170244 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
GOZ24_RS05865 | 1170402..1171001 | + | 600 | WP_002456349.1 | glucosamine-6-phosphate isomerase | Antitoxin |
GOZ24_RS05870 | 1171025..1171204 | + | 180 | WP_002468490.1 | hypothetical protein | Toxin |
GOZ24_RS05875 | 1171360..1171764 | + | 405 | WP_001829818.1 | hypothetical protein | - |
GOZ24_RS05880 | 1171949..1173334 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
GOZ24_RS05885 | 1173695..1174519 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
GOZ24_RS05890 | 1174678..1175811 | + | 1134 | WP_010959201.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1168282..1168437 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T288881 WP_002468490.1 NZ_LR735432:1171025-1171204 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22709.62 Da Isoelectric Point: 4.9942
>AT288881 WP_002456349.1 NZ_LR735432:1170402-1171001 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E9LUD0 |