Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 38805..38961 | Replicon | chromosome |
Accession | NZ_LR735429 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0704 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | GOZ23_RS00155 | Protein ID | WP_099560939.1 |
Coordinates | 38866..38961 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 38805..38841 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ23_RS00140 | 35127..35708 | + | 582 | WP_061544235.1 | restriction endonuclease subunit S | - |
GOZ23_RS00145 | 35709..37265 | + | 1557 | WP_061544234.1 | type I restriction-modification system subunit M | - |
GOZ23_RS12530 | 37258..37767 | + | 510 | Protein_26 | restriction endonuclease subunit S | - |
GOZ23_RS12535 | 37855..38496 | + | 642 | WP_196765188.1 | restriction endonuclease subunit S | - |
- | 38805..38841 | + | 37 | - | - | Antitoxin |
GOZ23_RS00155 | 38866..38961 | - | 96 | WP_099560939.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
GOZ23_RS00160 | 39162..39383 | - | 222 | WP_061544232.1 | hypothetical protein | - |
GOZ23_RS00165 | 39398..39901 | - | 504 | WP_037559702.1 | DUF1643 domain-containing protein | - |
GOZ23_RS00170 | 39916..40227 | - | 312 | WP_061544231.1 | hypothetical protein | - |
GOZ23_RS00175 | 40314..40664 | - | 351 | WP_061544230.1 | hypothetical protein | - |
GOZ23_RS00180 | 41169..42797 | - | 1629 | WP_061642462.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3503.15 Da Isoelectric Point: 7.9875
>T288873 WP_099560939.1 NZ_LR735429:c38961-38866 [Staphylococcus epidermidis]
MADILVNIMTTAASGCIVALFSYWLRKRDDK
MADILVNIMTTAASGCIVALFSYWLRKRDDK
Download Length: 96 bp
Antitoxin
Download Length: 37 bp
>AT288873 NZ_LR735429:38805-38841 [Staphylococcus epidermidis]
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
ATGCACCAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|