Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3520488..3521158 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | MBS3601_RS16435 | Protein ID | WP_003899954.1 |
Coordinates | 3520488..3520832 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | MBS3601_RS16440 | Protein ID | WP_003899955.1 |
Coordinates | 3520829..3521158 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS16405 | 3515561..3516421 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
MBS3601_RS16410 | 3516396..3516911 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
MBS3601_RS16415 | 3517151..3517444 | + | 294 | WP_003416635.1 | hypothetical protein | - |
MBS3601_RS16420 | 3517732..3519021 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
MBS3601_RS16425 | 3519368..3519802 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS16430 | 3519805..3520257 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MBS3601_RS16435 | 3520488..3520832 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MBS3601_RS16440 | 3520829..3521158 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
MBS3601_RS16445 | 3521696..3522043 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
MBS3601_RS16450 | 3522040..3522660 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
MBS3601_RS16455 | 3522820..3524085 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
MBS3601_RS16460 | 3524253..3524462 | + | 210 | WP_003416778.1 | hypothetical protein | - |
MBS3601_RS16465 | 3524709..3525743 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T288861 WP_003899954.1 NZ_LR699570:3520488-3520832 [Mycobacterium tuberculosis variant bovis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT288861 WP_003899955.1 NZ_LR699570:3520829-3521158 [Mycobacterium tuberculosis variant bovis]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |