Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4816115..4816781 | Replicon | chromosome |
Accession | NZ_LR699014 | ||
Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FYC27_RS23235 | Protein ID | WP_096759269.1 |
Coordinates | 4816464..4816781 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | FYC27_RS23230 | Protein ID | WP_003837894.1 |
Coordinates | 4816115..4816411 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC27_RS23215 | 4813291..4813764 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
FYC27_RS23220 | 4813991..4814710 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
FYC27_RS23225 | 4814707..4816059 | + | 1353 | WP_096759268.1 | two-component system sensor histidine kinase EnvZ | - |
FYC27_RS23230 | 4816115..4816411 | - | 297 | WP_003837894.1 | helix-turn-helix domain-containing protein | Antitoxin |
FYC27_RS23235 | 4816464..4816781 | - | 318 | WP_096759269.1 | toxin HigB-2 | Toxin |
FYC27_RS23240 | 4816905..4818527 | - | 1623 | WP_096759270.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
FYC27_RS23245 | 4818906..4820624 | + | 1719 | WP_096759271.1 | DUF4153 domain-containing protein | - |
FYC27_RS23250 | 4820675..4821553 | - | 879 | WP_096759272.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12213.13 Da Isoelectric Point: 9.8310
>T288795 WP_096759269.1 NZ_LR699014:c4816781-4816464 [Citrobacter werkmanii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIETPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIETPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSDMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|