Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2075994..2076556 | Replicon | chromosome |
Accession | NZ_LR699014 | ||
Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FYC27_RS10135 | Protein ID | WP_096757033.1 |
Coordinates | 2076278..2076556 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FYC27_RS10130 | Protein ID | WP_096757032.1 |
Coordinates | 2075994..2076278 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC27_RS10115 | 2071295..2074342 | + | 3048 | WP_137398860.1 | formate dehydrogenase-N subunit alpha | - |
FYC27_RS10120 | 2074356..2075240 | + | 885 | WP_096757030.1 | formate dehydrogenase N subunit beta | - |
FYC27_RS10125 | 2075233..2075889 | + | 657 | WP_096757031.1 | formate dehydrogenase-N subunit gamma | - |
FYC27_RS10130 | 2075994..2076278 | - | 285 | WP_096757032.1 | HigA family addiction module antidote protein | Antitoxin |
FYC27_RS10135 | 2076278..2076556 | - | 279 | WP_096757033.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC27_RS10140 | 2076744..2078459 | - | 1716 | WP_096757034.1 | ATP-binding cassette domain-containing protein | - |
FYC27_RS10145 | 2078770..2080467 | - | 1698 | WP_096757035.1 | malate dehydrogenase | - |
FYC27_RS10150 | 2080647..2080787 | - | 141 | WP_096757036.1 | stationary-phase-induced ribosome-associated protein | - |
FYC27_RS10155 | 2081016..2081447 | + | 432 | WP_096757037.1 | OsmC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10601.05 Da Isoelectric Point: 9.5320
>T288786 WP_096757033.1 NZ_LR699014:c2076556-2076278 [Citrobacter werkmanii]
MIMNFRHKGLRDLFLQGRTSGVTAKHVRRLRHRLAVIDAASHVTDINMPGYKLHALTGDRDGVWSISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLQGRTSGVTAKHVRRLRHRLAVIDAASHVTDINMPGYKLHALTGDRDGVWSISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|