Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4577374..4578026 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1Y4Y846 |
Locus tag | FYC31_RS21545 | Protein ID | WP_045289934.1 |
Coordinates | 4577670..4578026 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A089PP79 |
Locus tag | FYC31_RS21540 | Protein ID | WP_043082872.1 |
Coordinates | 4577374..4577673 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS21525 | 4572522..4574819 | - | 2298 | WP_048253925.1 | beta-glucosidase BglX | - |
FYC31_RS21530 | 4575026..4576753 | + | 1728 | WP_048253924.1 | D-lactate dehydrogenase | - |
FYC31_RS21535 | 4576757..4577311 | + | 555 | WP_043082873.1 | GNAT family N-acetyltransferase | - |
FYC31_RS21540 | 4577374..4577673 | - | 300 | WP_043082872.1 | helix-turn-helix transcriptional regulator | Antitoxin |
FYC31_RS21545 | 4577670..4578026 | - | 357 | WP_045289934.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC31_RS21550 | 4578209..4579153 | - | 945 | WP_048253923.1 | D-alanyl-D-alanine endopeptidase | - |
FYC31_RS21555 | 4579320..4579907 | - | 588 | WP_048253922.1 | YIP1 family protein | - |
FYC31_RS21560 | 4580082..4580657 | + | 576 | WP_048253921.1 | DedA family protein | - |
FYC31_RS21565 | 4580748..4581515 | - | 768 | WP_048253920.1 | SDR family oxidoreductase | - |
FYC31_RS21570 | 4581623..4582357 | + | 735 | WP_043082867.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13802.74 Da Isoelectric Point: 8.8875
>T288768 WP_045289934.1 NZ_LR699009:c4578026-4577670 [Pluralibacter gergoviae]
MWTVLFSQRFDDWLSEQEEALQEKVLADLGKLKAYGPNLPRPHADTLKGSRYNNMKELRIQFAGRPVRAFYAFDPVRHAI
VLCAGDKSSDKQFYDRMIRIADDEFSAHLARQEKEKIR
MWTVLFSQRFDDWLSEQEEALQEKVLADLGKLKAYGPNLPRPHADTLKGSRYNNMKELRIQFAGRPVRAFYAFDPVRHAI
VLCAGDKSSDKQFYDRMIRIADDEFSAHLARQEKEKIR
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y4Y846 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A089PP79 |