Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4344177..4344845 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FYC31_RS20470 | Protein ID | WP_106912900.1 |
Coordinates | 4344177..4344530 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FYC31_RS20475 | Protein ID | WP_045287872.1 |
Coordinates | 4344534..4344845 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS20440 | 4339276..4339695 | - | 420 | WP_043083055.1 | RNA polymerase-binding protein DksA | - |
FYC31_RS20445 | 4339803..4340042 | + | 240 | WP_043086484.1 | hypothetical protein | - |
FYC31_RS20450 | 4340045..4341232 | - | 1188 | WP_106912899.1 | GTP-binding protein | - |
FYC31_RS20455 | 4341593..4341919 | + | 327 | WP_106913037.1 | hypothetical protein | - |
FYC31_RS20460 | 4342024..4343478 | + | 1455 | WP_043083053.1 | AMP nucleosidase | - |
FYC31_RS20465 | 4343516..4343995 | - | 480 | WP_043083052.1 | GNAT family N-acetyltransferase | - |
FYC31_RS20470 | 4344177..4344530 | + | 354 | WP_106912900.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC31_RS20475 | 4344534..4344845 | + | 312 | WP_045287872.1 | XRE family transcriptional regulator | Antitoxin |
FYC31_RS20485 | 4345063..4346451 | - | 1389 | WP_043083047.1 | APC family permease | - |
FYC31_RS20490 | 4346718..4348136 | - | 1419 | WP_045287871.1 | glutamine synthetase family protein | - |
FYC31_RS20495 | 4348349..4349113 | + | 765 | WP_106913038.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase | - |
FYC31_RS20500 | 4349139..4349696 | + | 558 | WP_043083043.1 | HTH-type transcriptional regulator PuuR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13817.79 Da Isoelectric Point: 7.9969
>T288767 WP_106912900.1 NZ_LR699009:4344177-4344530 [Pluralibacter gergoviae]
VWNIQVTETYKLWHQALSAKDQARVLAMLDLLEKEGPRLGRPYADTIKGSRFSNMKELRIQRRGEPLRIFYVFSPEREGI
LLCAGNKSGDDKRFYDIMIPLADEEYTEYLNHFYQSR
VWNIQVTETYKLWHQALSAKDQARVLAMLDLLEKEGPRLGRPYADTIKGSRFSNMKELRIQRRGEPLRIFYVFSPEREGI
LLCAGNKSGDDKRFYDIMIPLADEEYTEYLNHFYQSR
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|