Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 1328996..1329645 | Replicon | chromosome |
| Accession | NZ_LR699009 | ||
| Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1S2BAV2 |
| Locus tag | FYC31_RS06350 | Protein ID | WP_048254040.1 |
| Coordinates | 1328996..1329337 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FYC31_RS06355 | Protein ID | WP_048253972.1 |
| Coordinates | 1329334..1329645 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC31_RS06325 | 1324362..1325804 | - | 1443 | WP_048253975.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
| FYC31_RS06330 | 1325807..1326718 | - | 912 | WP_048253974.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| FYC31_RS06335 | 1326835..1327722 | - | 888 | WP_048254041.1 | LysR family transcriptional regulator | - |
| FYC31_RS06340 | 1327825..1328235 | + | 411 | WP_048253973.1 | CidA/LrgA family protein | - |
| FYC31_RS06345 | 1328228..1328917 | + | 690 | WP_043081728.1 | LrgB family protein | - |
| FYC31_RS06350 | 1328996..1329337 | + | 342 | WP_048254040.1 | hypothetical protein | Toxin |
| FYC31_RS06355 | 1329334..1329645 | + | 312 | WP_048253972.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| FYC31_RS06360 | 1329685..1331334 | - | 1650 | WP_106912782.1 | cation/acetate symporter ActP | - |
| FYC31_RS06365 | 1331334..1331645 | - | 312 | WP_043081730.1 | DUF485 domain-containing protein | - |
| FYC31_RS06370 | 1331868..1333826 | - | 1959 | WP_048253970.1 | acetate--CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13422.37 Da Isoelectric Point: 9.7299
>T288756 WP_048254040.1 NZ_LR699009:1328996-1329337 [Pluralibacter gergoviae]
MDALFIELPPFERHRAEYFSDDDFKAFQQMLLHNPCAGDVIRGAGGLRKIRFADPRRNKGKRGGIRVIYYWYAEKSHFLL
FTLYDKEQQDDLTAHQRNILSHLLEQAKQRIIR
MDALFIELPPFERHRAEYFSDDDFKAFQQMLLHNPCAGDVIRGAGGLRKIRFADPRRNKGKRGGIRVIYYWYAEKSHFLL
FTLYDKEQQDDLTAHQRNILSHLLEQAKQRIIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|