Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 461045..461308 | Replicon | chromosome |
| Accession | NZ_LR699008 | ||
| Organism | Hafnia alvei isolate MGYG-HGUT-02508 | ||
Toxin (Protein)
| Gene name | hokH | Uniprot ID | A0A1C6YY26 |
| Locus tag | FYB81_RS02095 | Protein ID | WP_025798685.1 |
| Coordinates | 461150..461308 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sokH | ||
| Locus tag | - | ||
| Coordinates | 461045..461102 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB81_RS02075 | 456260..457330 | - | 1071 | WP_111328966.1 | dihydroxyacetone kinase subunit DhaK | - |
| FYB81_RS02080 | 457430..458530 | - | 1101 | WP_111328967.1 | glycerol dehydrogenase | - |
| FYB81_RS02085 | 459036..459719 | + | 684 | WP_043490623.1 | DUF1190 family protein | - |
| FYB81_RS02090 | 459722..460882 | + | 1161 | WP_025798684.1 | glutathionylspermidine synthase family protein | - |
| - | 461045..461102 | - | 58 | - | - | Antitoxin |
| FYB81_RS02095 | 461150..461308 | + | 159 | WP_025798685.1 | Hok/Gef family protein | Toxin |
| FYB81_RS02100 | 461469..463688 | - | 2220 | WP_025798687.1 | lysine decarboxylase | - |
| FYB81_RS02105 | 463794..465122 | - | 1329 | WP_111328968.1 | cadaverine/lysine antiporter | - |
| FYB81_RS02110 | 465616..466149 | + | 534 | WP_111328969.1 | SprT family zinc-dependent metalloprotease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6065.37 Da Isoelectric Point: 9.2226
>T288741 WP_025798685.1 NZ_LR699008:461150-461308 [Hafnia alvei]
MSRKLLLYGLIVMCFTLLIFTWMVRGSLCELRIKQGKTEVAAFLNYEDKHAL
MSRKLLLYGLIVMCFTLLIFTWMVRGSLCELRIKQGKTEVAAFLNYEDKHAL
Download Length: 159 bp
Antitoxin
Download Length: 58 bp
>AT288741 NZ_LR699008:c461102-461045 [Hafnia alvei]
GTTCAGATGTGGTTAGGATTGCCTCAGGTTAATGAAAATTGACCTGGGGCTTTTACTT
GTTCAGATGTGGTTAGGATTGCCTCAGGTTAATGAAAATTGACCTGGGGCTTTTACTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|