Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3737851..3738413 | Replicon | chromosome |
| Accession | NZ_LR699006 | ||
| Organism | Citrobacter freundii isolate MGYG-HGUT-02495 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1C0NXV4 |
| Locus tag | FYB80_RS17775 | Protein ID | WP_003833016.1 |
| Coordinates | 3738135..3738413 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FYB80_RS17770 | Protein ID | WP_047411217.1 |
| Coordinates | 3737851..3738135 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB80_RS17755 | 3735541..3736425 | + | 885 | WP_003833024.1 | formate dehydrogenase N subunit beta | - |
| FYB80_RS17760 | 3736418..3737074 | + | 657 | WP_003020054.1 | formate dehydrogenase-N subunit gamma | - |
| FYB80_RS17765 | 3737204..3737803 | + | 600 | WP_047411210.1 | inorganic diphosphatase | - |
| FYB80_RS17770 | 3737851..3738135 | - | 285 | WP_047411217.1 | HigA family addiction module antidote protein | Antitoxin |
| FYB80_RS17775 | 3738135..3738413 | - | 279 | WP_003833016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FYB80_RS17780 | 3738634..3740349 | - | 1716 | WP_047411222.1 | ATP-binding cassette domain-containing protein | - |
| FYB80_RS17785 | 3740814..3741716 | + | 903 | WP_043016304.1 | endonuclease/exonuclease/phosphatase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10667.30 Da Isoelectric Point: 9.8965
>T288736 WP_003833016.1 NZ_LR699006:c3738413-3738135 [Citrobacter freundii]
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|