Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1482241..1482907 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A5B0T6K1 |
Locus tag | FYB80_RS07100 | Protein ID | WP_047408175.1 |
Coordinates | 1482590..1482907 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | FYB80_RS07095 | Protein ID | WP_003837894.1 |
Coordinates | 1482241..1482537 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS07080 | 1479417..1479890 | - | 474 | WP_016154802.1 | transcription elongation factor GreB | - |
FYB80_RS07085 | 1480116..1480835 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
FYB80_RS07090 | 1480832..1482184 | + | 1353 | WP_043018579.1 | two-component system sensor histidine kinase EnvZ | - |
FYB80_RS07095 | 1482241..1482537 | - | 297 | WP_003837894.1 | helix-turn-helix domain-containing protein | Antitoxin |
FYB80_RS07100 | 1482590..1482907 | - | 318 | WP_047408175.1 | toxin HigB-2 | Toxin |
FYB80_RS07105 | 1483030..1484652 | - | 1623 | WP_043018578.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
FYB80_RS07110 | 1485230..1486108 | - | 879 | WP_016157640.1 | Hsp33 family molecular chaperone HslO | - |
FYB80_RS07115 | 1486133..1486534 | - | 402 | WP_019078146.1 | ribosome-associated heat shock protein Hsp15 | - |
FYB80_RS07120 | 1486545..1487213 | - | 669 | WP_003023533.1 | GMP/IMP nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12255.17 Da Isoelectric Point: 10.0909
>T288728 WP_047408175.1 NZ_LR699006:c1482907-1482590 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQETLIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQETLIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5B0T6K1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U6IRD5 |