Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 956901..957500 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FYB80_RS04605 | Protein ID | WP_047407483.1 |
Coordinates | 957189..957500 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FYB80_RS04600 | Protein ID | WP_047407480.1 |
Coordinates | 956901..957188 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS04585 | 954397..955299 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
FYB80_RS04590 | 955296..955931 | + | 636 | WP_047407477.1 | formate dehydrogenase cytochrome b556 subunit | - |
FYB80_RS04595 | 955928..956857 | + | 930 | WP_043018887.1 | formate dehydrogenase accessory protein FdhE | - |
FYB80_RS04600 | 956901..957188 | - | 288 | WP_047407480.1 | helix-turn-helix domain-containing protein | Antitoxin |
FYB80_RS04605 | 957189..957500 | - | 312 | WP_047407483.1 | hypothetical protein | Toxin |
FYB80_RS04610 | 957721..958629 | + | 909 | WP_047407486.1 | alpha/beta hydrolase | - |
FYB80_RS04615 | 958694..958936 | + | 243 | WP_003825282.1 | type II toxin-antitoxin system ParD family antitoxin | - |
FYB80_RS04620 | 958929..959216 | + | 288 | WP_003825284.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FYB80_RS04625 | 959222..960163 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
FYB80_RS04630 | 960208..960645 | - | 438 | WP_003028671.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
FYB80_RS04635 | 960642..961514 | - | 873 | WP_047407489.1 | virulence factor BrkB family protein | - |
FYB80_RS04640 | 961508..962107 | - | 600 | WP_043018883.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12270.39 Da Isoelectric Point: 10.0972
>T288726 WP_047407483.1 NZ_LR699006:c957500-957189 [Citrobacter freundii]
MLFIETEIFTEDVKKLLDDDEYRRLQIFLTIQPDCGDLIHDTGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
MLFIETEIFTEDVKKLLDDDEYRRLQIFLTIQPDCGDLIHDTGGLRKVRWRARGKGKRGGVRIIYFHQIRKSQIRLLLIY
QKGIKDDLTPQEKVLLRMLNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|