Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1337227..1337791 | Replicon | chromosome |
Accession | NZ_LR698988 | ||
Organism | Lacticaseibacillus paracasei isolate MGYG-HGUT-02388 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A510WIJ9 |
Locus tag | FX029_RS07275 | Protein ID | WP_016363448.1 |
Coordinates | 1337489..1337791 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | K6SLT0 |
Locus tag | FX029_RS07270 | Protein ID | WP_003570051.1 |
Coordinates | 1337227..1337496 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX029_RS07240 | 1332232..1333119 | - | 888 | WP_003570041.1 | ABC transporter ATP-binding protein | - |
FX029_RS07245 | 1333316..1334542 | - | 1227 | WP_003570043.1 | hypothetical protein | - |
FX029_RS07250 | 1334740..1335144 | + | 405 | WP_003570045.1 | MerR family transcriptional regulator | - |
FX029_RS07255 | 1335137..1335463 | + | 327 | WP_003584272.1 | YrdB family protein | - |
FX029_RS07260 | 1335526..1336155 | + | 630 | WP_003570047.1 | DUF2399 domain-containing protein | - |
FX029_RS07265 | 1336200..1336853 | + | 654 | WP_003570049.1 | GNAT family N-acetyltransferase | - |
FX029_RS07270 | 1337227..1337496 | + | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FX029_RS07275 | 1337489..1337791 | + | 303 | WP_016363448.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FX029_RS16035 | 1338130..1338273 | + | 144 | WP_172621778.1 | hypothetical protein | - |
FX029_RS07280 | 1338391..1339083 | + | 693 | WP_003570055.1 | hypothetical protein | - |
FX029_RS07285 | 1339319..1341496 | + | 2178 | WP_003570057.1 | RNA-binding transcriptional accessory protein | - |
FX029_RS07290 | 1341921..1342478 | - | 558 | WP_003584278.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11510.33 Da Isoelectric Point: 9.8881
>T288716 WP_016363448.1 NZ_LR698988:1337489-1337791 [Lacticaseibacillus paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A510WIJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BRK6 |